SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021778 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021778
Domain Number 1 Region: 80-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-42
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 529-639
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000526
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 318-382
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000103
Family VWC domain 0.016
Further Details:      
 
Domain Number 4 Region: 490-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000244
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 738-810
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000617
Family VWC domain 0.01
Further Details:      
 
Domain Number 6 Region: 679-744
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000303
Family VWC domain 0.0093
Further Details:      
 
Domain Number 7 Region: 445-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 645-686
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021778
Domain Number - Region: 374-448
Classification Level Classification E-value
Superfamily FnI-like domain 0.000209
Family VWC domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021778   Gene: ENSNLEG00000017926   Transcript: ENSNLET00000022878
Sequence length 866
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:67207787:67594853:1 gene:ENSNLEG00000017926 transcript:ENSNLET00000022878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGFPPLLKGQASATRSSLASCSWVVFFLSCLSRHAPKSSGGRRWTELIRTMESRVLLRTF
CLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPGLHNGTKAFLFQDTPRSIKAS
TATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELESSGHRNEVRLHYR
SGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPSTDLPLGTTFW
LGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQKIMELQDILAK
TSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPN
PDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVE
SSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSVCRNLNDRAVCSCRDGFRA
LREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITNQ
HNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANVCACPQGFTGP
SCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCEDIDECGTGR
HSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRCSVCSCQNGFV
MCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQQCRCLQGEVD
CWPLPCPDVECEFSILPENECCPRCVTDPCQADTIRNDITKTCLDEMNVVRFTGSSWIKH
GTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences ENSNLEP00000021778 ENSNLEP00000021778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]