SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021785 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021785
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily C-type lectin-like 6.59e-53
Family Link domain 0.0000000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021785   Gene: ENSNLEG00000017932   Transcript: ENSNLET00000022885
Sequence length 742
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:49809195:49910643:1 gene:ENSNLEG00000017932 transcript:ENSNLET00000022885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGSYIFYTFSTVHSIPDEDGPWITDSTDRTPATTLMSTSATAAERATKRQE
TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEEERERHLSFSGSGIDDD
EDFISSTISTTPRVFDHTKQNQDWTQRNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGSWN
PEAHSPLIHHEHHEEEETPHSTSTIQATPSSTMEETATQKEQWFGNRWHEGYRQTPREDS
HLTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFDPISHPMGRGHQAGRRMDMDSSHSTT
LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
TGGRRDPNHFEGSTTLLEGYTSHYPHTKESRTFIPVTSVKTGSFGVTEVTVGDSNSNVNH
SLSGDQDAFHPSGGSHTTHGSESAGHSRGSQEGGANTTSGPIRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET
PDQFITADETRNLQNVDMKIGV
Download sequence
Identical sequences G1S8E6
ENSNLEP00000021785 ENSNLEP00000021785 XP_003254461.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]