SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021790 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021790
Domain Number 1 Region: 175-225
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021790
Domain Number - Region: 14-71
Classification Level Classification E-value
Superfamily RING/U-box 0.00306
Family Zf-UBP 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021790   Gene: ENSNLEG00000017939   Transcript: ENSNLET00000022890
Sequence length 344
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:50363070:50503860:1 gene:ENSNLEG00000017939 transcript:ENSNLET00000022890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEEHRQKFLSHHLAEY
VHGAQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDE
SDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCP
DHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVER
LKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ
SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Download sequence
Identical sequences G1S8F1
ENSNLEP00000021790 XP_003254477.1.23891 ENSNLEP00000021790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]