SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021808 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021808
Domain Number 1 Region: 600-806
Classification Level Classification E-value
Superfamily Fibronectin type III 1.33e-32
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 2 Region: 806-988
Classification Level Classification E-value
Superfamily Fibronectin type III 7.51e-26
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 3 Region: 240-334
Classification Level Classification E-value
Superfamily Immunoglobulin 4.74e-20
Family I set domains 0.00061
Further Details:      
 
Domain Number 4 Region: 412-509
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 5 Region: 327-409
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-17
Family I set domains 0.00029
Further Details:      
 
Domain Number 6 Region: 57-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000191
Family I set domains 0.004
Further Details:      
 
Domain Number 7 Region: 136-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000677
Family I set domains 0.00026
Further Details:      
 
Domain Number 8 Region: 499-573
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000289
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021808   Gene: ENSNLEG00000017950   Transcript: ENSNLET00000022909
Sequence length 1016
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:71127458:71297284:-1 gene:ENSNLEG00000017950 transcript:ENSNLET00000022909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENIRGKDKHQARIYVQASPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLSNAYLVIRNAEFRKFKVRTYLIDSLVGIHFITQIFISG
PPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIEGN
MEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGAAPNVAPSDVGGGGGRNRE
LTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMSPSTAFQV
KVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESYQI
RYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFTKK
APPSQPPRIISSIRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKHSI
EVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF
Download sequence
Identical sequences ENSNLEP00000021808 ENSNLEP00000021808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]