SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021812 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021812
Domain Number 1 Region: 819-883
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000314
Family ATI-like 0.033
Further Details:      
 
Domain Number 2 Region: 364-422
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000798
Family ATI-like 0.045
Further Details:      
 
Domain Number 3 Region: 717-781
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000392
Family ATI-like 0.037
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021812
Domain Number - Region: 1195-1249
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000327
Family ATI-like 0.092
Further Details:      
 
Domain Number - Region: 860-922
Classification Level Classification E-value
Superfamily FnI-like domain 0.000586
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number - Region: 421-462
Classification Level Classification E-value
Superfamily FnI-like domain 0.0115
Family Fibronectin type I module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021812   Gene: ENSNLEG00000017954   Transcript: ENSNLET00000022913
Sequence length 1640
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:71779091:71860696:-1 gene:ENSNLEG00000017954 transcript:ENSNLET00000022913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLILWYLVMALWCFCKDMEALLYRQKSEIQKRESGGFFYGSSSSGDSDRKKPLFSFEFG
ATGEDEDKSRERWDAGNSRSEDSPAGVTSSSEYSTSGPLNTPEKGSHIPEATPKYSETNA
IIGEVSTWSKGAYKSFNGRIFFFESSCPYTFCRHCVESGGDFNIEIKRNNDSEIEKITVL
IDNNDISIFGDTILVNGESVQIPYNNKLIHIKKYGEHNVLNSRRGILTLMWDKNNKVSLT
LHKQYPTCGLCGNFNSTPGQDINEHIANSKIPGDCPSAVGKSYEVCEDGMQHCNKIIGTY
FEKCRKVAALSGDYKMICIDEYCQTRDKTSTCDTYSELSRLCASDGPGTFESWRSDSDVV
CETHRCPEQHIYKECGPSNPATCSNVAPFQDSECVSGCTCPEGYLLDDIGEKGKCVLKAE
CPCESSGKVYQPGEVREGPCGSQCTCQDAKWSCTEALCPGRCKVEGSSLTTFDGVKYNFP
GNCHFLAIHNEDWSISVELRPCPSGQTGTCLNSVTLLLNSSVPVDKYIFNSDGTVTNDKI
RNQGYYYSDKIQIFNASSSYLQVETYFHVKLQIQIVPVMQLYVSMPPNQFTDTVGLCGSY
NNRAEDDFMSSQNILEKTSQAFANSWEMMSCPKGNPPSCISIEKEKFAERHCGILLDSSG
PFASCHPIVNPKPYHEECKKYTCTCENSQDCLCTILGNYVKACAEKETYIAGWRTGLCEH
SCPSGLVFKYNVKACNSSCRSLSERDRSCDVEDVPVDGCTCPDEMYQNNEGNCVLKSQCD
CYINDEVMQPGKLIHIDDNKCVCRDGILLCQIPIDLTLQNCSGGAEYVDCSDPKAQRRTD
RTCSTRNIPVFDENLPCKRGCFCPEGMVRNSKGICVFPDDCPCSFGGREYDEGSVTSVGC
NECTCIKGSWSCTQNECQTICHIYGEGHVRTFDGKSYSFDGLCQYSFLEDYCGHENGTFR
ILTESVPCCEDGLTCSRKIIVSFQDQNVVLQDGKVTAVKSTESKKCELNANAYSIHTVGL
YLILKFQNGIIVIWDKNTRLSVILDPNWNGRVCGLCGNNNGDLKDDFTTRYSSVASGALE
FGNSWKTSQECADTVAQTFPCDSNPYCKAWAVRKCEILRDSTFRDCHNKVDPSAYYDACV
EEACACDMEGKYLGFCTAVAMYAEACSAVGVCVSWRKPNLCPVYCDYYNAPGECRWHYEP
CGTVTAKTCKDQLIGQKFSSLLEGCYAKCPDSAPYLDENTMKCVSLSECSCFYNDVIPAG
GVIEDNCGRTCYCIAGQLECSETAPTNSTFAVSTTAATAILSTGAAITLVTSSPGSAASI
PAITTSSSETTGATLGPLTEPFTTGITETSVPIISTSGNAGTTGVVSPTITGAAGMAGTT
GGVDAATTGAAGENTSERAGTPGVSGATPAVGVGSTPGEAGPGATVSGSTGVSAGSTTAS
PGASATTSESSKSGTTGPSVGGKTGATSSEATSSEVMSGVTGQSLGSTAASDSEITAKTS
FTGSSPPGKLTRPSPGSPGHFSGGTTEGGSVATTGAGGENTSGASGSTEGSVEATTSAGS
GNTAGTSGTGATGPGNTAVSGTPVVPPGPTPGAPGSSTPEEAGTGTTSFGKSGSLTVSAA
STTSSPVSKHTDAASATAVT
Download sequence
Identical sequences ENSNLEP00000021812 ENSNLEP00000021812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]