SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021857 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021857
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily RNI-like 2.28e-48
Family Rna1p (RanGAP1), N-terminal domain 0.065
Further Details:      
 
Domain Number 2 Region: 399-633
Classification Level Classification E-value
Superfamily L domain-like 8.16e-47
Family Ngr ectodomain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021857   Gene: ENSNLEG00000017991   Transcript: ENSNLET00000022960
Sequence length 663
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:319519:343075:-1 gene:ENSNLEG00000017991 transcript:ENSNLET00000022960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGARARGAQLRLGERVRPVGRGSAPGRSRYRALAAGVPSALAPPAGTMAQSRALLLLLL
LPPQLHLGPVLAMRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAISCPRDC
ACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRL
TSRGLPEKAFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPN
LRSVYLHNNKLADAGLPDNMFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEK
IPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNLSRVPAGLPRSLV
LLHLEKNAIRSVDADVLTPIRSLEYLLLHSNQLQAQGIHPLAFQGLKRLHTVHLYNNALE
RVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLL
RSLDLSGNRLHTLPPGLPRNVHVLKVKRNELAALARGALAGMAQLRELYLTSNRLRSRAL
GPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKIGAVPANAFDSTPNLKGIF
LRFNKLAVGSVVDSAFRRLKHLQVLDIEGNFEFGDVSKDRGRLGKGKEEEKEEEEEEEEE
ETR
Download sequence
Identical sequences ENSNLEP00000021857 ENSNLEP00000021857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]