SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021886 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021886
Domain Number 1 Region: 827-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000893
Family Laminin-type module 0.0000555
Further Details:      
 
Domain Number 2 Region: 723-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 285-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 4 Region: 883-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000014
Family Laminin-type module 0.00017
Further Details:      
 
Domain Number 5 Region: 934-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 446-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 397-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 341-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000201
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 772-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.00021
Further Details:      
 
Domain Number 10 Region: 1281-1525
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000144
Family Tropomyosin 0.00074
Further Details:      
 
Domain Number 11 Region: 982-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021886
Domain Number - Region: 1081-1282
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000628
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0099
Further Details:      
 
Domain Number - Region: 99-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00468
Family Galactose-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021886   Gene: ENSNLEG00000018016   Transcript: ENSNLET00000022993
Sequence length 1608
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:3333117:3464349:1 gene:ENSNLEG00000018016 transcript:ENSNLET00000022993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSHRAAPALRPRGRLWPVLAVLAAAAAGCARAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDSELYRST
GHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRVEQRDGSEASLEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQRLLNNLTSIKIRGTYS
ERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSPC
VLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSC
AVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNPYGTVKQQSSCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGIT
GQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGSRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAERE
VMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVENT
ERLIEIASRELEKTKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANDTSTEAYNLLLRTLAGENETAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAG
DKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEHLIDQKLKDYEDLREDMRGKELEV
KNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNK
TAAEEALRKIPAINQTIIEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEI
NARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDL
ENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
Download sequence
Identical sequences G1S8P7
ENSNLEP00000021886 ENSNLEP00000021886 XP_003264486.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]