SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021906 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021906
Domain Number 1 Region: 2474-2573
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-25
Family I set domains 0.0083
Further Details:      
 
Domain Number 2 Region: 3627-3719
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-24
Family I set domains 0.0078
Further Details:      
 
Domain Number 3 Region: 3241-3342
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-24
Family I set domains 0.005
Further Details:      
 
Domain Number 4 Region: 2393-2481
Classification Level Classification E-value
Superfamily Immunoglobulin 2.34e-24
Family I set domains 0.022
Further Details:      
 
Domain Number 5 Region: 1166-1263
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-24
Family I set domains 0.0071
Further Details:      
 
Domain Number 6 Region: 2582-2669
Classification Level Classification E-value
Superfamily Immunoglobulin 8.52e-24
Family I set domains 0.0098
Further Details:      
 
Domain Number 7 Region: 3066-3153
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-23
Family I set domains 0.009
Further Details:      
 
Domain Number 8 Region: 603-700
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-23
Family I set domains 0.02
Further Details:      
 
Domain Number 9 Region: 4077-4171
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-23
Family I set domains 0.013
Further Details:      
 
Domain Number 10 Region: 2680-2768
Classification Level Classification E-value
Superfamily Immunoglobulin 5.99e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 11 Region: 2959-3058
Classification Level Classification E-value
Superfamily Immunoglobulin 6.11e-23
Family I set domains 0.0052
Further Details:      
 
Domain Number 12 Region: 2299-2387
Classification Level Classification E-value
Superfamily Immunoglobulin 9.25e-23
Family I set domains 0.016
Further Details:      
 
Domain Number 13 Region: 3979-4078
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-22
Family I set domains 0.032
Further Details:      
 
Domain Number 14 Region: 3902-3994
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 15 Region: 1821-1920
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 16 Region: 2789-2871
Classification Level Classification E-value
Superfamily Immunoglobulin 5.08e-22
Family I set domains 0.021
Further Details:      
 
Domain Number 17 Region: 3708-3806
Classification Level Classification E-value
Superfamily Immunoglobulin 5.17e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 18 Region: 1366-1455
Classification Level Classification E-value
Superfamily Immunoglobulin 7.48e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 19 Region: 2879-2967
Classification Level Classification E-value
Superfamily Immunoglobulin 8.02e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 20 Region: 3146-3246
Classification Level Classification E-value
Superfamily Immunoglobulin 8.49e-22
Family I set domains 0.0095
Further Details:      
 
Domain Number 21 Region: 3800-3899
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 22 Region: 889-983
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-21
Family I set domains 0.0081
Further Details:      
 
Domain Number 23 Region: 42-217
Classification Level Classification E-value
Superfamily vWA-like 1.89e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 24 Region: 2102-2197
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-21
Family I set domains 0.007
Further Details:      
 
Domain Number 25 Region: 786-885
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 26 Region: 1447-1548
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-21
Family I set domains 0.036
Further Details:      
 
Domain Number 27 Region: 4164-4262
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 28 Region: 1086-1177
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 29 Region: 1744-1828
Classification Level Classification E-value
Superfamily Immunoglobulin 3.29e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 30 Region: 1542-1641
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-20
Family I set domains 0.0042
Further Details:      
 
Domain Number 31 Region: 2008-2107
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 32 Region: 3535-3622
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 33 Region: 3443-3529
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-20
Family I set domains 0.0086
Further Details:      
 
Domain Number 34 Region: 518-617
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-20
Family I set domains 0.056
Further Details:      
 
Domain Number 35 Region: 1918-2014
Classification Level Classification E-value
Superfamily Immunoglobulin 8.41e-20
Family I set domains 0.026
Further Details:      
 
Domain Number 36 Region: 1634-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-20
Family I set domains 0.0043
Further Details:      
 
Domain Number 37 Region: 3352-3435
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 38 Region: 1277-1361
Classification Level Classification E-value
Superfamily Immunoglobulin 3.68e-19
Family I set domains 0.0054
Further Details:      
 
Domain Number 39 Region: 2191-2292
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-19
Family I set domains 0.0079
Further Details:      
 
Domain Number 40 Region: 981-1074
Classification Level Classification E-value
Superfamily Immunoglobulin 2.33e-17
Family I set domains 0.0082
Further Details:      
 
Domain Number 41 Region: 701-799
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 42 Region: 445-523
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000172
Family I set domains 0.033
Further Details:      
 
Domain Number 43 Region: 4250-4300
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000158
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021906   Gene: ENSNLEG00000018033   Transcript: ENSNLET00000023014
Sequence length 4301
Comment pep:novel supercontig:Nleu1.0:GL397296.1:6138265:6532648:1 gene:ENSNLEG00000018033 transcript:ENSNLET00000023014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWEVVHTVFLFALLYSSLAQDASPPSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRTH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWRIPF
DPSLKEVTVSLSGPSPMIEIRNPLGKLIKKGFGLNELLNIHNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISTPARID
LLELLSISGSSLKTIPVKYYADRKPYGIWNISDFVPPNEAFFLKVTGYDKDDYLFQRVSS
VSFSSIVPDAPKVMMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGVTLGVDQYMKESA
SVNLDIEKVTLSDEGFYECIAVSSAGTGRAQTFFDVSEPPPVIQVPNNVTVTPGETAVLT
CLIISVVDYNLTWQRNDRDVRLAEPARIRTLANLSLELKSVKFNDAGEYHCMVSSEGGSS
AASVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTVNDTFIVGSHRYRM
TSDGTLFIKNAAPKDAGIYGCLASNSAGTDKQSSTLRYIEAPKLMVVQSELLVALGDITL
MECKTSGIPPPQVKWFKGDLELRPSAFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGR
ATGKITLDVGSPPVFIQEPADVSMEIGSNVTLLCYVQGYPEPTIKWRRLDNMPIFSRPFS
VSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTITVTGLVAPLIGISPSVAN
VIEGQQLTLPCTLLAGNPIPERRWIKNSAMLLQNPYITMRSDGSLHIERVQLQDGGEYTC
VASNVAGTSNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCKASGIPKPSVIWSKKGEL
ISTSSAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVYVRPRVFGDQRG
LSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITET
RTPDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLP
VITWSKGGSTMLVDGVHHVSNPDGTLSIDQAAPSDAGIYTCVATNIAGTDETEITLHVQE
PPTVEDLEPPYNTPFQERVANQRIAFPCPAKGTPKPTIKWLRNGRELIGREPGISILEDG
TLLVIASVTLYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNL
FCEVEGTPSPIITWYKDNVQVTESSTIQIVNNGKILKLFKATPEDAGSYSCKAINIAGTS
QKYFNIDVLVPPTIIGTNFPNEVSVALNHDIALECQVKGTPFPDIHWFKDGKPLFLGDPN
VELLDRGQVLHLKNARRSDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVL
INSIIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSATYMCHV
ANVAGTAEKSFHVDVYVPPMIEGDLATPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGV
PVKANDNIRIEAGGKKLEIMSAQEMDQGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDE
ISYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSDT
GLYRCMAANTAGDHKKEFEVTVHVPPAIKSSGLSERVVVKYKPVTLQCIANGIPNPSITW
LKDDQPVNTAQGNLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAGETQQHIQLHVHEPPS
LEDAGKMLNETVVVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQIIDIES
AQISDAGIYKCMAINSAGATELFYSLQVHVAPSISGSNNMVAVVVNNPVRLECEARGIPA
PSLTWLKDGSPVSSFSNGLQVLSGGRILAFTSAQISDTGRYTCVAVNAAGEKQRDIDLRV
YVPPNIMGEEQNVSVLISQAVELLCQSDAIPPPTLTWLKDGHPLLKKPGLSISENGSVLK
IEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCES
SGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTATK
EYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKDGRPLVKAKGVE
ILDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIRNHRSPENISVVE
KNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTVEDAGQYTCVVR
NAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVMLTCEATGNPVPEITWHKDGQPL
QEDEAHHIMSGGRFLQITNVQVPHTGRYTCLASSPAGDKSRSFSLNVFVSPTIAGVGSDG
SPEDVTVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPGGRTLQILNAQEDN
AGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYA
IPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNVAGEDELDFDV
NIQVPPSFQKLWEIGNMLDTSRNGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTS
SDKVLILPGGRVLQIPRAKVEDAGKYTCVAVNEAGEDSLQYDVRVLVPPIIKGANSDLPE
EVTVLVNKSALMECLSSGNPAPRNSWQKDGQPSLEDDHHKFLSNGRILQILNTQIIDIGR
YVCVAENTAGSAKKYFNLNVHVPPSVIGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLK
NEQPIKLNTNALIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKYSLTVYVPPSIKD
HDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITESTHLEILADGQMLHIKKA
EVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPEREVIVETISNPVTLTCDATGIPP
PTIAWLKNHKRIENSDSLEVHILSGGSKLQIARSQRSDSGNYTCIASNMEGKAQKYYFLS
IQVPPSVSGAEIPSDVSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERIRVSAN
GSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTIRDNKDEAEKLMTLVDTSI
NIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIVRAQVSDVAVYTCVASNRAG
VDNKHYNLQVFAPPNMDNSMGTEEITILKGSSTSMACITDGTPAPSMAWLRDGQPLGLDA
HLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKVLEPPHINGSEEHEEISV
IVNNPLELTCIASGIPAPKMTWMKDGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCL
ASSPAGDDDKEYLVRVHVPPNIAGTDEPQDITVLRNRQVTLECKSDAVPPPVITWLKNGE
RLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQ
SLVILLNKSTVLECITEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGR
YLCMATNAAGTDRRRIDLQVHVPPSIAPGPTNMTVTVNVQTTLACEATGIPKPSINWRKN
GHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDKRTVDLTVQVPPSIA
DEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGVRLLPRGDGYRILSSGAIEILATQLN
HAGRYTCVARNAAGSAHRHVTLHVHEPPVIQPQPSELHVILNNPILLPCEATGTPSPFIT
WQKEGISVNTSGKNHAVLPSGGLQISKAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPV
ISPHLKEYVIAVDKPITLPCEADGLPPPDITWHKDAHAIVESIRQRVLSSGSLQIAFVQP
GDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPAPAI
NWKKDNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLP
TFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNIIP
Download sequence
Identical sequences ENSNLEP00000021906 ENSNLEP00000021906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]