SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021916 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021916
Domain Number 1 Region: 59-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.53e-195
Family Myeloperoxidase-like 0.0000000000000142
Further Details:      
 
Domain Number 2 Region: 19-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000457
Family EGF-type module 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021916   Gene: ENSNLEG00000018039   Transcript: ENSNLET00000023024
Sequence length 604
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:7074466:7083086:-1 gene:ENSNLEG00000018039 transcript:ENSNLET00000023024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARALLLCAVLALSHAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLLLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNVDY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NVMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQNYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPDYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFASFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
Download sequence
Identical sequences G1S8S7
ENSNLEP00000021916 ENSNLEP00000021916 XP_003264523.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]