SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021933 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021933
Domain Number 1 Region: 1166-1230
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.01e-20
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Domain Number 2 Region: 144-216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000751
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 867-927
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000406
Family Complement control module/SCR domain 0.0000185
Further Details:      
 
Domain Number 4 Region: 1109-1168
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000971
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 5 Region: 689-744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000162
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 629-686
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000038
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1041-1103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000391
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 8 Region: 85-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000162
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 9 Region: 924-985
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000017
Family Complement control module/SCR domain 0.0000329
Further Details:      
 
Domain Number 10 Region: 982-1044
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000021
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 11 Region: 809-864
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000577
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 12 Region: 561-624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000839
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 13 Region: 508-572
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000183
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 14 Region: 205-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000275
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 15 Region: 262-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000301
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 16 Region: 454-512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000472
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 17 Region: 389-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000197
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 18 Region: 30-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000262
Family Complement control module/SCR domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021933
Domain Number - Region: 324-384
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000278
Family Complement control module/SCR domain 0.006
Further Details:      
 
Domain Number - Region: 766-803
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0229
Family Complement control module/SCR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021933   Gene: ENSNLEG00000018052   Transcript: ENSNLET00000023041
Sequence length 1231
Comment pep:novel supercontig:Nleu1.0:GL397296.1:16720836:16815792:1 gene:ENSNLEG00000018052 transcript:ENSNLET00000023041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLAKIICLMLWAICVAEDCNELPPRKNTEILTGSWSDQTYPEGTQATYKCRPGYISHG
NIIMVCRKGEWVALNPLKKCQKRPCGHPGDTPFGSFSLTGGNVFEYGVKAVYTCNEGYQL
LGEINYRECDTAGWTNDIPICEVVKCLPVTAPENGKIVSGAMEPDREYHFGQAVQFACNS
GYKIEGDKEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNSG
YEYSERGDAVCTESGWHPLPSCEEKTCNAPYIPNGVYSPLRIKHRTGDEIRYQCINGFYP
ATRGNTAKCTSTGWIPAPRCTLKPCDYPNIKHGGLYYESLRRPYFPVAVGKYYAYHCDES
FETPSGSYWDNIHCTQDGWSPAVPCLRKCYFPYLENAYNQNHGRKFVQGNSVEVDCHPGY
SLPKAQTTVTCMENGWSLTPRCIRVKTCSKSSIDIENGFISESQYTYALNKKVKYQCKLG
YVTADGETSGSITCGKNGWSAQPTCIKSCDMPVFMNARAKNDITWFKLNDILDYECHDGY
ESTNGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPG
FTIVGPNSIQCYHFGLSPDLPICKEQVQSCGPPPELLNGDVKEKRKEEYGHSEVVEYYCN
PRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGYAQFSSPPYYYGDSVEFNCS
ESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIIIEGNFINKKEFDHNSNIRYR
CRGKEEHIQAVCINGRWDPEVTCSMAQMQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQ
ENYLIQEGEEITCKDGRWQSIPRCVEKIPCSQPPPIEHGTINSSRSSQESYAHGTKLSYT
CEGGFRLSEENETTCYMGKWSSPPQCEGLPCKSPPEISQGAVAHMSDSYQYGEEVTYKCF
EGFGIDGPAIAKCLGEKWSQPPSCIKTDCLSLPSFENAIPMGEKKDSYKSGEQVTYTCAT
HYKMDGPSNVTCINSRWTGRPTCRDTSCVNPPTVQNAHIVSRQKSKYPSDERVSYECRSP
YEMFGEKEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDTTSFPLSVYAPDSSVEYKCQD
LYQLEGNKRITCRNGQWSEPPKCSHPCVISREIMEKYNITLRWIAKHKLYSRTGESVEFV
CRPGYRLSPSSHTLRTRCWDGKLEYPSCVKR
Download sequence
Identical sequences G1S8U4
XP_003264549.1.23891 ENSNLEP00000021933 ENSNLEP00000021933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]