SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021936 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021936
Domain Number 1 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.46e-22
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 2 Region: 149-208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000709
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 3 Region: 85-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000556
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 23-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000181
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021936   Gene: ENSNLEG00000018053   Transcript: ENSNLET00000023044
Sequence length 270
Comment pep:novel supercontig:Nleu1.0:GL397296.1:16931687:16947316:1 gene:ENSNLEG00000018053 transcript:ENSNLET00000023044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLMVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCDYNFV
SPSKSFWTRIICTEEGWSPAPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRL
QNNEKNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFPLSVYAQDSSVDYQCQN
LYQLEGNKRITCRNGQWSEPPKCLHPCVISQEIMEKYSITLKWTNQQKLYARTGDIVEFV
CKSGYHPTKSHSFRAMCQNGKLVYPSCEEK
Download sequence
Identical sequences G1S8U7
ENSNLEP00000021936 XP_003264548.1.23891 ENSNLEP00000021936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]