SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021937 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021937
Domain Number 1 Region: 581-660
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.52e-21
Family Complement control module/SCR domain 0.006
Further Details:      
 
Domain Number 2 Region: 453-533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.98e-20
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000202
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 333-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000537
Family Complement control module/SCR domain 0.00064
Further Details:      
 
Domain Number 5 Region: 396-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000288
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000836
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 522-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000197
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 8 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000446
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 9 Region: 89-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000354
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 10 Region: 25-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000367
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021937   Gene: ENSNLEG00000018054   Transcript: ENSNLET00000023045
Sequence length 661
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:17027581:17059997:-1 gene:ENSNLEG00000018054 transcript:ENSNLET00000023045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCL
AGYTTESGRQEERTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCAS
GYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVNDKVQYEC
ATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKHTYEEGDVVQFF
CHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHI
ECELNFEIHGSEEIRCEDGKWTEPPKCIEGQEKVACEEPPFVENGAANLHSKIYYNGDKV
TYACKSGYLLHGLNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGLLASYATGSS
VEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGD
LIDFVCKQGYDLSPLTPLSELSVQCDRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSIV
DTYENGSSVEYRCFDHHFLQGSREAYCLEGMWTTPPLCLEPCTLSSAEMEKNNLLLKWDF
DNRPHILHGEYIEFLCRGDTYPAELYNTGSILRMQCDRGQLKYPRCIPRQRTLSYQEPLR
T
Download sequence
Identical sequences G1S8U8
ENSNLEP00000021937 XP_003264551.1.23891 ENSNLEP00000021937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]