SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021949 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021949
Domain Number 1 Region: 630-910
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000286
Further Details:      
 
Domain Number 2 Region: 922-1225
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-81
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000533
Further Details:      
 
Domain Number 3 Region: 390-562
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000112
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021949   Gene: ENSNLEG00000018065   Transcript: ENSNLET00000023059
Sequence length 1304
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:18671020:18796979:1 gene:ENSNLEG00000018065 transcript:ENSNLET00000023059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMYLWLKLLAFGFAFLDTEVFVTGQSQTPSPTGSTTAKMPSVPLSSDPLPTHTTAFSPA
SISERENDFSETTPSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPPA
GTDTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAAL
PARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANIIVDYL
YNKETKEFMAKLNVNEKVECGNNNCTNNEVHKLAECKEINVSISHNSCTSYKELKLDVPP
GVEKFQLRDCTKDEKADTTICLKWEQIETFDCGTNKITYRFQCGNTTFDKKEINLENLKP
EHEYKCDSEILYNNRTYTNTSKIIKTDFGTPGEPQNISCRSTAAHQGVIAWIPPQRSFHN
FTLCYENKTGKKCLNLRKNLREYNLQNFKPYTKYNLSLHAYIIAKVQRNGTAATCNFTTK
SAPPSRVQNMTVSTSENSMSVKCRAPRDLNGPNGHYRLEVEAGNTLVRNESRDNCDFYVK
DLQYLTDYSFKAYYHNGDYSGEPFILHKSTSYNSKALIAFLAFLIIVTSIALLVVLYKIY
DLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPR
VFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKY
IAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVK
INQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFS
NFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAESKVDVYGYVVKLRRQRCLMVQVEAQY
ILIHQALVEYNQFGETEVNLSELHPYLHNIKKRDPPSEPSPLEAEFQRLPSYRSWRTQHI
GNQEENKNKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASF
IMSYWKPEMMIAAQGPLKETIGDFWQMILQRKVKVIVMLTELKHGDQEICAQYWGEGKQT
YGDIEVDLKDTDKSSTYTFRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQ
VLKQKLPQKNSSEGNKHHKSIPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQVVK
ALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNSHQEDKIEFDNEVDKVKQDANCV
NPLGAPEKLPEAKEQAEGSEPTSSTEGPEHSVNGPASPALNQGS
Download sequence
Identical sequences ENSNLEP00000021949 ENSNLEP00000021949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]