SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021961 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021961
Domain Number 1 Region: 738-927
Classification Level Classification E-value
Superfamily Fibronectin type III 9.43e-39
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 2 Region: 1149-1241
Classification Level Classification E-value
Superfamily Immunoglobulin 2.6e-19
Family I set domains 0.0059
Further Details:      
 
Domain Number 3 Region: 28-122
Classification Level Classification E-value
Superfamily Immunoglobulin 7.5e-18
Family I set domains 0.0079
Further Details:      
 
Domain Number 4 Region: 1028-1128
Classification Level Classification E-value
Superfamily Fibronectin type III 8.52e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 460-548
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000196
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 938-1039
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000462
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 306-395
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000176
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 557-645
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000275
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 240-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000093
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021961   Gene: ENSNLEG00000018077   Transcript: ENSNLET00000023073
Sequence length 1242
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:21206379:21238609:1 gene:ENSNLEG00000018077 transcript:ENSNLET00000023073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGKLRKSHIPGVSIWQLVEEIPEGCSTPDFEQKPVTLALPEGKNAIFRAVVCGEPRPEVR
WQNSKGDLGDSSKYKISSSPGSKEHVLQINKLTGEDTDLYRCTAVNVYGEAACSARLTVI
EVGFRKNRKRHKEPQEDLRNELMDFRKLLKKRAPPAPKKKVDLEQIWQLLMTADRKDYEQ
ICLKYGIVDYRGMLRRLQEMKKEQEDKMAQYLNAISSLRHIRVTKDGIAKFDLELDLKDS
QSKIYLYKDGEMIPYGFNNQTKHCLRRLGKRYEFQIQDLRPEDAGIYQVKVEDAVVFSTE
LEASAIPPRVVVPLAETHCEEQGDAVFECTLSSPCPSAAWHFRHRLLHPSDKYEVFVSPD
GLTHQLVVRGVRFSDMGPYSLGTGLYTSSAWLVVEAGKDKDLQSTSADHQLQRQRAQASG
AEDRLDIYGERGDATRSSTSRYKPGTGSFSKDARGPMGHFSQGLADIEVHQGEAATLSCT
LTSDLGPGTWFKDGVKLTAEDGVIFKQDGLMHSLFITHVQGTQAGRYTFVAGDQQSEATL
TVQDSPTIAPDVTEKLREPLVVKAGKPVTVKIPFQSHLPIQAAWRKDGAEVVGSGDREAQ
VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAKLTLQVIGTSPVFSQPRPENQHSA
GLLLGGRSRKLLGRMVVPSPEWRQQGRTALGRAGAHTSHRTVGLGGAGAFHGTSLGACVS
QGSLDSLWLTGIFLAPALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK
GSNTWTAVNDQPVPERKWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP
GLVRNLQVTDTSNTSITLSWAGPDTQDGDEAQGYVVELCSSDSLQWLPCHAGTVPVTTYT
AKGLRPGEGYFVRVTAVNEGGQSQPTALDTLVQAMPVTVCPKFLVDSSTKDLLMVKVGDT
VRVPVSFEAMPMPEVTWLKDGLPLPKRSVTITKDGLTQLLIPVAGLSDSGLYTVVLRTLQ
GKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEARDVPLHYAVFTRSSAHG
PWREAADRIHTNHFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRNRFTVKS
PSYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYS
TDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVI
Download sequence
Identical sequences ENSNLEP00000021961 ENSNLEP00000021961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]