SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022002 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022002
Domain Number 1 Region: 360-452
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-23
Family I set domains 0.0049
Further Details:      
 
Domain Number 2 Region: 245-335
Classification Level Classification E-value
Superfamily Fibronectin type III 7.3e-20
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 3 Region: 67-174
Classification Level Classification E-value
Superfamily Fibronectin type III 1.15e-18
Family Fibronectin type III 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022002   Gene: ENSNLEG00000018110   Transcript: ENSNLET00000023116
Sequence length 457
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:23208387:23215707:-1 gene:ENSNLEG00000018110 transcript:ENSNLET00000023116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEENTSEGPACSPEETTSESAKVPTAQPPGEVAVSESTGEEQVPKPQAPAPQSPAASTA
TKPAPPSEDVPSAPLLLTLEDVSNSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPV
SARPMMVIQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQPIHIRENIEAPKIRVPRHL
RQTYIRQVGETVNLQIPFQVGIPPTKAERVMGTGQGVWQEPNLGGGALCQPGHHAHFPSH
SGPTEKPGPPSSIRLLDVWGCNDALQWTPPQDTGNTELLGYTVQKADKKTGQWFTVLERY
HPTTCTISDLIIGNSYSFRVFSENLCGLSASATVTKELAHIQKADIAAKPKGFIERDFSE
APSFTQPLADHTSTPGYSTQLSCSVRASPKPKIIWMKNKMEIQGNPKYRALSEQGVCTLE
IRKPSPFDSGVYTCKAINVLGEASVDCRLEVKASATH
Download sequence
Identical sequences ENSNLEP00000022002 ENSNLEP00000022002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]