SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022097 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022097
Domain Number 1 Region: 49-126
Classification Level Classification E-value
Superfamily Ribosomal protein S18 4.71e-24
Family Ribosomal protein S18 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022097   Gene: ENSNLEG00000018188   Transcript: ENSNLET00000023213
Sequence length 141
Comment pep:novel supercontig:Nleu1.0:GL397393.1:736298:736720:1 gene:ENSNLEG00000018188 transcript:ENSNLET00000023213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVAVCGGLGRKKLTHLVTAAVSLTHPGTPTVLSRRGCSQYKQVSSIEDLPTPMENPYKES
LKKCILRGKHVNYKNAQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQITGFMP
VTYKDPAYLKDTKVCNIRYQE
Download sequence
Identical sequences ENSNLEP00000022097 ENSNLEP00000022097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]