SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022165 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022165
Domain Number 1 Region: 10-71
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000183
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022165   Gene: ENSNLEG00000018261   Transcript: ENSNLET00000023286
Sequence length 220
Comment pep:known_by_projection supercontig:Nleu1.0:GL397365.1:3397542:3398204:-1 gene:ENSNLEG00000018261 transcript:ENSNLET00000023286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTLV
CPICRYVTFLSKKSSRWPSMLDKSSQTLAVPVGLPSVPPLDSLGHTNPLAASSSAWRPPL
GQARPPGSPGQSAQLSLDLLPSLPRESQVFVISRHGMPLGEQDSVLPRRSLAELSEASPA
PRSARAFCCRSRALLLITLIAVVAVVAAILPWVLLVRKQA
Download sequence
Identical sequences G1S9H4
ENSNLEP00000022165 XP_003274703.1.23891 ENSNLEP00000022165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]