SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022237 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022237
Domain Number 1 Region: 260-310
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000353
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 2 Region: 193-228
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000235
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022237   Gene: ENSNLEG00000018333   Transcript: ENSNLET00000023358
Sequence length 343
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:15579227:15580258:-1 gene:ENSNLEG00000018333 transcript:ENSNLET00000023358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQLSPGKAADQVCTFLFKKPGRKGAAGRRKRPASAPEPGESGSSSDEGCTVVRPEKKR
VTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVY
ELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRK
GPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGR
YGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCD
QQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT
Download sequence
Identical sequences G1S9P6
ENSNLEP00000022237 XP_003262309.1.23891 ENSNLEP00000022237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]