SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022357 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022357
Domain Number 1 Region: 230-354
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-32
Family Cadherin 0.00076
Further Details:      
 
Domain Number 2 Region: 443-570
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-29
Family Cadherin 0.003
Further Details:      
 
Domain Number 3 Region: 343-447
Classification Level Classification E-value
Superfamily Cadherin-like 6e-25
Family Cadherin 0.0044
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-20
Family Cadherin 0.0092
Further Details:      
 
Domain Number 5 Region: 559-670
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-16
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 29-102
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000542
Family Cadherin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022357   Gene: ENSNLEG00000018464   Transcript: ENSNLET00000023489
Sequence length 807
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8181008:8183431:1 gene:ENSNLEG00000018464 transcript:ENSNLET00000023489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFSRRGGLGAWDLLLSLLLLAAWEVGSGQLHYSIPEEAKHGTFVGRVAQDLGLELAELV
PRLFRVASKTHRDLLEVNLQNGILFVNSRIDREELCQWSAECSIHLELMADSPLQVFHVE
VKVKDINDNPPVFRGREQIIFIPESRLLNSRFPIEGAADADIGANALLTYTLSPSDYFSL
DVEASDELSKSLWLELRKSLDREETPELHLLLTATDGGKPELQGTVELLITVLDVNDNAP
LFDQAVYRVHLSETTANGTLVTTLNASDADEGVNGEVVFSFDSGISRDIQEKFKVDSSSG
EIRLIDKLDYEETKSYEIQVKAVDKGSPPMSNHCKVLVKVLDVNDNAPELAVTSLYLPIR
EDAPLSTVIALITVSDRDSGANGQVTCSLMPHVPFKLVSTFKNYYSLVLDSALDRESLSV
YELVVTAQDGGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAR
DADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDA
GVPPLGSNVTLQVFVLDENDNAPELLVPRVGGTIGAVSELVPRLVGAGHVVAKVRAVDAD
SGYNAWLSYELQPAAGGAHIPFCVGLYTGEISTTRDLDEADLSRYRLLVLVKDHGEPALT
ATATVLVSLVESGQAPKASSRASVGVAGPEAALVDVNVYLIIAICAVSSLLVLTLLLYTA
LRCSVPPTKGACAPGKPTLVCSSAVGSWSNSQQRRQRVCSSEGPPKTDLMAFSPGLSPSL
NMSERNEQPEANLDLSGNVSPTFEFWL
Download sequence
Identical sequences ENSNLEP00000022357 ENSNLEP00000022357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]