SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022358 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022358
Domain Number 1 Region: 230-355
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-31
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 443-570
Classification Level Classification E-value
Superfamily Cadherin-like 8.38e-29
Family Cadherin 0.0031
Further Details:      
 
Domain Number 3 Region: 343-447
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-24
Family Cadherin 0.0041
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-21
Family Cadherin 0.0069
Further Details:      
 
Domain Number 5 Region: 559-670
Classification Level Classification E-value
Superfamily Cadherin-like 3e-17
Family Cadherin 0.0024
Further Details:      
 
Domain Number 6 Region: 29-110
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022358   Gene: ENSNLEG00000018465   Transcript: ENSNLET00000023490
Sequence length 824
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8196434:8198908:1 gene:ENSNLEG00000018465 transcript:ENSNLET00000023490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSWREDPGAQCLLLSLLLLAAWEVGSGQLHYSVSEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVD
VEVKDINDNAPVFPMAVKNLFISESRQPGSRFSLEGASDADIGTNSLLTYSLDSTEYFTL
DVKRNDEEIKSLGLVLKKNLNREDTPKHYLLITAIDGGKPELTGTTQLKITVLDVNDNAP
AFERTIYKVRLFENAPNGTLVVTVNATDLDEGVNKDIAYSFNTDMSADILSKFHLDPVNG
QISVKGNIDFEESKSYEIQVEATDKGNPPMSDHCTVLLEIVDINDNVPELVIKSLSLPVL
EDSPLSTVIALISVSDRDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDSALDRESVSA
YELVVTARDGGSPSLWATAGVSVEVADVNDNAPVFAQSEYTVFVKENNPPGCHIFTVSAR
DADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSAHDA
GVPPLGSNVTLQVFVLDENDNAPALLTPRVGGIGGAVSELVPRSVGAGHVVAKVRAVDAD
SGYNAWLSYELQPGTGGARIPFRVGLYTGEISTTRALDEVDAPRHRLMVLVKDHGEPSLT
ATATVLVSLVESGQAPKASSQASAGATGPEAALVDVNVYLIVAICAVSSLLVLTLLLYTA
LRCSAPPTEGACGLGKPTLVCSSAVGSWSYSQQRQQRVCSGEGLPKTDLMAFSPSLPPCP
NSRDREEKQDVDVDLSAKVSNFYLFFPKCLCFSFLNVSTPLEIH
Download sequence
Identical sequences ENSNLEP00000022358 ENSNLEP00000022358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]