SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022359 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022359
Domain Number 1 Region: 230-354
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 443-569
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-29
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 344-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-23
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 126-234
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-20
Family Cadherin 0.0028
Further Details:      
 
Domain Number 5 Region: 559-670
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000126
Family Cadherin 0.0031
Further Details:      
 
Domain Number 6 Region: 30-108
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000528
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022359   Gene: ENSNLEG00000018466   Transcript: ENSNLET00000023491
Sequence length 798
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8202341:8204906:1 gene:ENSNLEG00000018466 transcript:ENSNLET00000023491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSWGSGQESRRLLLLLLLLAAWEGGNGQLHYSVSEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKGRGGLLEVNLQNGILFVNSRIDREELCRRSAECSIHLEVIVDRPLQVFHVD
VEVRDINDNPPVFAATQKNLSIAESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFSL
EKPSDDELVKGLGLILRKSLDREEAPEICLVLTATDGGKPELTGTVQLLITVLDANDNAP
AFDRTIYKVRLPENVPNGTLVIKLNASDLDEGLNGDIVYSFSNDISPNVKSKFHIDPITG
QIIVKGYIDFEESKSYEIIVEGVDKGQLPLSGHCRVIVEVEDSNDNIPDLEFKSLSLPIR
EDAPLGTVIALISVSDKDMGVNGLVTCFLTSHVPFKLVSTFKNYYSLVLDSALDRESVSA
YELVVTARDRGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAR
DADAQENAMVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDG
GVPPLGSNVTLQVFVLDENDNAPALLAPRAGGIGGAVSELVPWSVGAGHVVAKVRAVGAD
SGYNAWLSYELQPGTGGARIPFRVGLYTGEISTTRALDETDAPRHRLLVLVKDHGEPELT
ATATVLVSLVESGQAPKASSRALAGAVGPEAVLVDVNIYLIIAICAVSSLLVLTLLLYTA
LRCSAPPTEGACARVKPTLVCSSAVGSWSYSQQRRPRVCSGEGPPKTDLMAFSPSLPDSR
DREDQLQTTEESFAKVSV
Download sequence
Identical sequences ENSNLEP00000022359 ENSNLEP00000022359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]