SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022360 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022360
Domain Number 1 Region: 442-568
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-28
Family Cadherin 0.003
Further Details:      
 
Domain Number 2 Region: 229-352
Classification Level Classification E-value
Superfamily Cadherin-like 1.15e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 342-446
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-24
Family Cadherin 0.0044
Further Details:      
 
Domain Number 4 Region: 126-233
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-23
Family Cadherin 0.0051
Further Details:      
 
Domain Number 5 Region: 558-669
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-18
Family Cadherin 0.0022
Further Details:      
 
Domain Number 6 Region: 29-108
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000228
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022360   Gene: ENSNLEG00000018467   Transcript: ENSNLET00000023492
Sequence length 816
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8212090:8214540:1 gene:ENSNLEG00000018467 transcript:ENSNLET00000023492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYSRRGSLGSRLLLLWLLLAYRKAGSGQLHYSIPEEAKHGTFVGRIAQDLGLELAELVP
RLFRVASKGRGDLLEVNLQNGILFVNSRIDREELCRRSAECSIHLEVIVDRPLQVFHVEV
AVKDINDNPPRFSRQEQRLFILESRMPDSRFPVEGASDLDIGANAQLRYRLNPNEYFDLD
VKTNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVLDANDNAPE
FDKSIYNVRLLENAPSGTLVIKLNASDADEGLNKEIVYFFSNLVLDDVKSKFIINSNTNS
TTFKGELDYEDCNSYEINIDAMDKSTFPLSGHCKVVVKLLDVNDNIPEMAITSLFLPVKE
DAPLSTVIALITVSDRDSGVNGQVTCSLMPHVPFKLVSTFKNYYSLVLDSALDRESVSAY
ELVVTARDGGSPSLWATASLSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARD
ADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAG
VPPLGSNVTLQVFVLDENDNAPALLAPRVGGPGGAVSKLVPRSVGAGHVVAKVRAVDPDS
GYNAWLSYELQPAPGSTRIPFRVGLYTGEISTTRSLDETEAPRHRLLVLVKDHGEPPLTA
TATVLVSLVESGQAPKASSWASEGAVGPEAALVDVNVYLIIAICAVSSLLVLTLLLYTAL
RCSAQPTEVVCTRGKPTLVCSSAVGSWSYSQQRRQRVCSGEAPPKTDLMAFSPSLPQGPT
STDDVSFLILTSNFPSQFLNIKCHIHPLFLYLKIKS
Download sequence
Identical sequences ENSNLEP00000022360 ENSNLEP00000022360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]