SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022362 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022362
Domain Number 1 Region: 231-361
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-30
Family Cadherin 0.00099
Further Details:      
 
Domain Number 2 Region: 440-572
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-24
Family Cadherin 0.0079
Further Details:      
 
Domain Number 4 Region: 341-445
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-20
Family Cadherin 0.0056
Further Details:      
 
Domain Number 5 Region: 556-665
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-17
Family Cadherin 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000022362
Domain Number - Region: 31-97
Classification Level Classification E-value
Superfamily Cadherin-like 0.000104
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022362   Gene: ENSNLEG00000018469   Transcript: ENSNLET00000023494
Sequence length 797
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8526990:8529507:1 gene:ENSNLEG00000018469 transcript:ENSNLET00000023494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGEGKERVPKQRQVLIFFVLLGIAQASSQPRHYSVAEETESGSFVANLLKDLGLEIGE
LAVRGARVVSKGKKMHLQFDRQTGDLLLNEKLDREELCGPTEPCVLPFQVLLENPLQFFQ
AELRIRDINDHSPVFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHF
HLNLQDSLDGILPQLVLNRALDREEQPEIRLTLTALDGGTPPRSGTALVRIEVVDINDNV
PEFAKLLYEVQIPEDSPVGSQVAIVSAKDLDIGTNGEISYAFSQASEDIRKTFRLSAKSG
ELLLRQKLDFESIQTYTVNIQATDGGGLSGTCVVFVQVMDLNDNPPELTVSTLINQIPEN
LQDTLIAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVENFYTLVISTALDRETRSEYNI
TITVTDLGTPRLKIEHNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVKATDRD
SGTNAQVTYSLLPPQDLHLPLASLVSINADNGHLFALQSLDYEALQAFEFLVGATDRGSP
ALSSEALVRVLVLDANDNSPFVLYPLQNSSAPCTELVPRVAEPGYLVTKVVAVDGDSGQN
AWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDVAKHRLVVLVKDNGEPPRSATATLH
VLLVDGFSQPYLPLPEAAPAQTQADSLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRA
ASVGRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLTGGSETNEFKFLKPIIPNFVAQGA
ERVSEANPSFRKSFEFS
Download sequence
Identical sequences ENSNLEP00000022362 ENSNLEP00000022362 XP_003266550.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]