SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022363 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022363
Domain Number 1 Region: 439-572
Classification Level Classification E-value
Superfamily Cadherin-like 5.2e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 230-360
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-24
Family Cadherin 0.004
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.0035
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-17
Family Cadherin 0.0032
Further Details:      
 
Domain Number 6 Region: 31-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000186
Family Cadherin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022363   Gene: ENSNLEG00000018470   Transcript: ENSNLET00000023495
Sequence length 796
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8532836:8535328:1 gene:ENSNLEG00000018470 transcript:ENSNLET00000023495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGGERFLRQRQVLLLFVFLGGSLAGCESRRYSVAEEKERGFLIANLAKDLGLRVEELA
ARGAQVVSKWNKQHFQLSHQTGDLLLNEKLDREELCGPTEPCILHFQILLQNPLQFVTND
LHIIDVNDHSPVFFENEMHLKILESTLPGTVIPLGNAEDLDVGRNSLQNYTITPNSHFHV
LTRSRRDGRKYPELVLDKALDREEQPELSLTLTALDGGAPPRSGTAQINIQVLDINDNAP
EFAQPLYEAAVLENTPVNSVIVTVSASDLDTGSFGTISYAFFHASEEIRKTFQLNPITGD
MQLVKYLNFEAINSYEVDIEAKDGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENS
GETVLAVFSVSDLDSGDNGRVMCSIENNLPFVLKPSVENFYTLVSEGALDRETRSEYNIT
ITVTDLGTPRLKTEYNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVRATDRDS
GTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPA
LSSEALVRVRVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA
WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDVAKHRLVVLVKDNGEPPRSATATLHV
LLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAA
SVGRCSVPEGPFPGHLVDVSGSGTLSQSYQYEVCLTGGSETNEFKFLKPIIPNFVAQGAE
RVSEANPSFRKSFEFS
Download sequence
Identical sequences G1SA22
ENSNLEP00000022363 XP_003266552.1.23891 ENSNLEP00000022363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]