SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022364 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022364
Domain Number 1 Region: 229-360
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-31
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 438-571
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 126-233
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-24
Family Cadherin 0.0047
Further Details:      
 
Domain Number 4 Region: 339-443
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.0046
Further Details:      
 
Domain Number 5 Region: 554-663
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-18
Family Cadherin 0.0032
Further Details:      
 
Domain Number 6 Region: 27-94
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000005
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022364   Gene: ENSNLEG00000018471   Transcript: ENSNLET00000023496
Sequence length 795
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8553399:8556170:1 gene:ENSNLEG00000018471 transcript:ENSNLET00000023496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLGRIHPNRQVLAFILMVFLSQVRPEPIRYSVLEEIESGSFVAHLAKDLGLGIGELAA
RSARVVSDDDKQRLQLDRQSGDLLLREKLDREELCGPVEPCVLHFQVFLEMPVQFFQGEL
LIQDINDHSPVFPEREVLLKILENSQPGTLFPLLIAEDLDVGSNGLQKYTISPNSHFHIL
TRNHSEGKKYPDLVQDKPLDREEQPEFSLTLVALDGGSPPRSGTVMVRILIMDINDNAPE
FVHTPYGVQVLENSPLDSPIIRVLATDVDAGNFGSVSYGLFQASDEIKQTFSINEFTGEI
LLKKQLDFEKIKSYHVEIEATDGGGLSGKGTVVIEVVDVNDNPPELIISSLTSSIPENAP
ETVVSIFRIRDRDSAENGKMICSIPDNLPFILKPTLKNFYTLVTERPLDRETSAEYNITI
TVTDLGTPRLKTQQTITVQVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVKATDRDSG
TNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPAL
SSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAW
LSYQLLKATEPGLFGVWAHNGEVRTTRLLSERDVAKHRLVVLVKDNGEPPRSATATLHVL
LVDGFSQPYLPLPEAAPARAQADSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRAAS
VGRCSVTEVPFPGHLVDVSGTGTLSQSYQYEVCLTGDSGTGEFKFLRPIFPNLLVQDTGR
EVKENPKFRNSLVFS
Download sequence
Identical sequences G1SA23
ENSNLEP00000022364 XP_003266553.1.23891 ENSNLEP00000022364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]