SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022365 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022365
Domain Number 1 Region: 231-363
Classification Level Classification E-value
Superfamily Cadherin-like 2e-33
Family Cadherin 0.00064
Further Details:      
 
Domain Number 2 Region: 440-573
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-24
Family Cadherin 0.0037
Further Details:      
 
Domain Number 4 Region: 341-444
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-22
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 556-665
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-18
Family Cadherin 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000022365
Domain Number - Region: 32-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.000121
Family Cadherin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022365   Gene: ENSNLEG00000018472   Transcript: ENSNLET00000023497
Sequence length 801
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8662702:8665462:1 gene:ENSNLEG00000018472 transcript:ENSNLET00000023497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASGKLICRQRQVLFSFLLLGLSLAGAAEPRRYSVVEETEGSSFVTNLAKDLGLEQREF
SRRGVRVVSRGNKLHLQLNQETGDLLLNEKLDREDLCGHTEPCVLRFQVLLESPFEFFQA
ELQVIDINDHSPVFLDKQMLVKVSESSPPGTTFPLKNAEDLDVGQNNIENYIISPNSYFR
VLTRKRSDGRKYPELVLDKALDREEEAELRLTLTALDGGSPPRSGTAQVYIEVLDVNDNA
PEFEQPFYRVQISEDSPVGFLVVKVSATDVDTGVNGEISYSLFQASDEISKTFKVDFLTG
EIRLKKQLDFEKLQSYEVNIEARDAGGFSGKCTVLIQVMDVNDHAPEVTMSAFTSPIPEN
QPETVVALFSVSDLDSGENGKISCSIQEDLPFLLKSSAENFYTLLTERPLDRESRAEYNI
TITVTDLGTPMLKTQLNMTVLVADINDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRD
SGTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQGFEFRVGASDRGSP
ALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRGAEPGYLVTKVVAVDGDSGQN
AWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDVAKHRLVVLVKDNGEPPRSATATLH
VILVDGFSQPYLPLPEAAPAEAQAQADSLTVYLVVALASVSSLFLFSVLLFVVLRLCRRS
RAASAGRCSVPEGPFPGHLVDVSGTETLSQNYQYEVCLAGGWGTNEFKFLKPIIPNFPPQ
CPGKEIQGNSTFRNNFGFNIQ
Download sequence
Identical sequences G1SA24
XP_003266556.1.23891 ENSNLEP00000022365 ENSNLEP00000022365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]