SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022367 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022367
Domain Number 1 Region: 230-361
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-32
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 439-572
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-28
Family Cadherin 0.00098
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-22
Family Cadherin 0.0054
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-20
Family Cadherin 0.0065
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-17
Family Cadherin 0.0031
Further Details:      
 
Domain Number 6 Region: 31-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000157
Family Cadherin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022367   Gene: ENSNLEG00000018474   Transcript: ENSNLET00000023499
Sequence length 787
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8693536:8696303:1 gene:ENSNLEG00000018474 transcript:ENSNLET00000023499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAGERFPEQRQVLILLLLLEVTLAGWEPRRYSVMEETERGSFVANLANDLGLGVGELA
ERGARVVSEDNEQGLQIDLQTGQLILNEKLDREKLCGPTEPCIMHFQVLLKKPLEVFRAE
LLVTDINDHSPEFPEREMTLKIPETSSLGTVFPLKKARDLDVGSNNVQNYNISPNSHFHV
STRTRGDGRKYPELVLDTELDREEQAELRLTLTAVDGGSPPRSGTVQILILVLDVNDNAP
EFVQAFYEVQVPENSPIGFLVVKVSARDLDTGTNGEISYSLYYSSQEINKPFELSSLSGE
IRLIKKLDFETMSSYDLEIEASDGGGLSGKCSVSVKVLDVNDNFPELSISSLTSPIPENS
LETEVALFRIRDRDSGENGKMICSIQDDVPFKLKPSVENFYRLVTEGALDRETRAEYNIT
ITITDLGTPRLKTEQSITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDS
GTNAQITYSLLPPQDPHLPLASLVSINTDNGHLFALISLDYEALQAFEFRVGATDRGSPA
LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRVAEPGYLVTKVVAVDGDSGQNA
WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDVAKHRLVVLVKDNGEPPRSATATLQV
LLVDGFSQPYLPLPEEAPAQAQADSLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAA
SVGRCSVPKGPFPGHLVDVSGSGTLSQSYQYKVCLTGGSETNDFKFLKPIFPNIVSQDSR
RKSEFLE
Download sequence
Identical sequences G1SA26
ENSNLEP00000022367 ENSNLEP00000022367 XP_003266563.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]