SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022369 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022369
Domain Number 1 Region: 441-565
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-31
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 236-339
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-25
Family Cadherin 0.0029
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-20
Family Cadherin 0.0086
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 3.38e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 31-105
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000116
Family Cadherin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022369   Gene: ENSNLEG00000018476   Transcript: ENSNLET00000023501
Sequence length 823
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8778951:8781564:1 gene:ENSNLEG00000018476 transcript:ENSNLET00000023501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIQKKLTGCSRLMLLCLSLELLLEAGAGNIHYSVPEESDKGSFVGNIAKDLGLQPQELA
DRGVRIVSRGRMPLFALNPRSGSLITAGRIDREELCAQSMPCLVSFNILVEDKMKLFPVE
VEIIDINDNTPQFQLEELEFKMNEITTPGTRISLPFGQDFDVGMNSLQSYQLSSNPHFSL
DVQQGAHGPQHPEMVLQSPLDREEEAVHHLILTASDGGEPVRSGTLRIYIQVVDANDNPP
AFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFHNVDHRVAQIFHLDSYTGE
ISNKEPLDFEEYKIYSMEVQAQDGAGLMAKTKVLVNVLDVNDNAPEVTITSVTTAVPENF
PPGTIIALISVHDQDSGDNGYTTCFIPGSLPFKLEKLVDNYYRLVTERILDRELISEYNI
TVTATDQGTPALSTETHISLLVTDINDNSPVFHQDSYSAYIPENNPRGASIFSVRAHDLD
SNENAQITYSLIEDTIQGAPLSAYLSINSDTGVLYALRSFDYEQFRDLQLKVMARDSGDP
PLSSNVSLSLFVLDQNDNPPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDSLKQSLVVAVQDHGQPPLSATVTL
TVAVADRIPDILGDLGSLEPSAKPNDSDLTLYLVVAVAAVSCVFLVFVIVLLAHRLRRWH
KSRLLQASGGGLASMPGSHFVGMDGVRAFLQTYSHEVSLTADSRKSHLIFPQPNYADTLI
SQESCEKKDFLSAHQSLLEDKKEPFSQVNFCDECISYLEKNNS
Download sequence
Identical sequences ENSNLEP00000022369 ENSNLEP00000022369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]