SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022370 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022370
Domain Number 1 Region: 441-565
Classification Level Classification E-value
Superfamily Cadherin-like 5.76e-30
Family Cadherin 0.0025
Further Details:      
 
Domain Number 2 Region: 235-340
Classification Level Classification E-value
Superfamily Cadherin-like 9.29e-28
Family Cadherin 0.00073
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 9.29e-25
Family Cadherin 0.0036
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-20
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 30-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000871
Family Cadherin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022370   Gene: ENSNLEG00000018477   Transcript: ENSNLET00000023502
Sequence length 823
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8787236:8789809:1 gene:ENSNLEG00000018477 transcript:ENSNLET00000023502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALQKLPHCRKLVLLCFLLATLWEARAGQIRYSVREEIDRGSFVGNIAKDLGLEPLALA
EQGVRIVSRGRTQHFALNPRSGSLLTANRIDREELCAQSAPCLLNFNILLEDKLTIYSVE
VEITDINDNAPRFGVEELELKISETTTPGFRIPLKNAHDADVGENALQKYALNPNDHFSL
DVRSGADGNKYPELVLELALDREEEAVHHLLLVASDGGDPELSGTSRICVKVLDVNDNPP
VFTQPEYRISVPENTPVGTRILTVTATDADEGYNAQVAYFLEKSPGETSEVFELKSTSGD
LTIIKDLDYEDATFHEIDIEAQDGPGLLTRTKVIVTVLDVNDNAPEFYMTSATSSVSEDS
PPGTIIGLFNVHDRDSGQNAFTTCSLPENLPFKLEKSVDNYYRLVTTRALDREQFSFYNI
TLIAKDGGNPSLSTDAHILLQVADINDNAPAFSRTSYSTYIPENNPRGASIFSVTAHDPD
SNDNAHVTYSFAEDTVHGAPLSSYISINSDTGVLYALRSFDYEQLRDLQLWVIARDSGNP
PLSSNVSLSLFVLDQNDNLPEILYPAFPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADRIPDILGDLGNLEPLAKPDDSDLTLYLVVAVAVVSCVFLAFVIMLLVHRLRCWH
KSRLLQASGGSLTGMQSSHFVGVDGVRAFLQTYSHEVSLIADSRKSHLIFPQPNYADTLI
SQESCEKKDFLSAPQSLPEDEREETFSQVIYLFTTYVLASLLK
Download sequence
Identical sequences ENSNLEP00000022370 ENSNLEP00000022370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]