SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022376 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022376
Domain Number 1 Region: 361-705
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.81e-95
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000834
Further Details:      
 
Domain Number 2 Region: 193-299
Classification Level Classification E-value
Superfamily RING/U-box 5.89e-17
Family Zf-UBP 0.011
Further Details:      
 
Domain Number 3 Region: 130-140,205-228
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000602
Family Formin homology 2 domain (FH2 domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022376   Gene: ENSNLEG00000018483   Transcript: ENSNLET00000023508
Sequence length 711
Comment pep:known_by_projection supercontig:Nleu1.0:GL397665.1:198254:200389:-1 gene:ENSNLEG00000018483 transcript:ENSNLET00000023508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVRETSLPSGSGARWISGGGGGASLEEAVEKAGKMEEAAAGATKASSRREAEEMKLEP
LQEREPAPEENLTWSSSGGDEKVLPSIPLRCHSSSSPVCPRRKPRPRPQPRARSRSQPGL
SAPPPPPARPPPPPPPPPPPTPRPRAWRGSRRRSRPGSRPQTRRSCSGDLDGSGDPGGLG
DWLLEVEFGQGPTGCSHVESFKVGKNWQKNLRLIYQRFVWSGTPETRKRKAKSCICHVCS
THMNRLHSCLSCVFFGCFTEKHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDKDIEQI
AKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQSTCETKEQEPKLVKPKKKRRKKSVYTV
GLRGLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYS
GSRTPHIPYKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSGGQEANNPNCC
NCIIDQIFTGGLQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFDSQNPERADSTVSRD
DHIPGIPSLTDCLQWFTRPEHLGSSAKIKCNSCQSYQESTKQLTMKKLPIVACFHLKRFE
HVGKQRRKINTFISFPLELDMTPFLASTKDSRMKEGQPPTDCVPNENKYSLFAVINHHGT
LESGHYTSFIRQQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHKQGLEKD
Download sequence
Identical sequences G1SA35
XP_003282162.1.23891 ENSNLEP00000022376 ENSNLEP00000022376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]