SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022431 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022431
Domain Number 1 Region: 31-238
Classification Level Classification E-value
Superfamily L domain-like 9.64e-35
Family Ngr ectodomain-like 0.0068
Further Details:      
 
Domain Number 2 Region: 285-389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000326
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022431   Gene: ENSNLEG00000018539   Transcript: ENSNLET00000023564
Sequence length 504
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:37943982:37945496:-1 gene:ENSNLEG00000018539 transcript:ENSNLET00000023564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWLVLLGALLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGLGMQDVPAELP
AATADLDLSHNALQRLRPGWLAPLFQLRALHLGHNELDALGRGVFANASGLRLLDLSSNA
LRALGRHDLDGLGALEKLLLFNNRLMHLDEHAFHGLRALSHLYLGCNELASFSFDHLHGL
SATHLLTLDLSSNRLGHISVPELAALPAFLKSGLYLHNNPLPCDCRLYHLLQRWHQRGLS
AVRDFAREYVCLAFKVPTSRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYC
NTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLH
HNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWS
GTPSPLQELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLYN
PGGLQLKAGSESASSVGSEGPMTT
Download sequence
Identical sequences G1SA89
ENSNLEP00000022431 ENSNLEP00000022431 XP_012352607.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]