SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022468 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022468
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily Immunoglobulin 3.46e-33
Family V set domains (antibody variable domain-like) 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022468   Gene: ENSNLEG00000018576   Transcript: ENSNLET00000023601
Sequence length 102
Comment pep:novel supercontig:Nleu1.0:GL397431.1:1129962:1130267:-1 gene:ENSNLEG00000018576 transcript:ENSNLET00000023601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIVMTQTPLSLPVTPGEPTSISCRSSQSLLHSDGCTYLAWYLQKPGQSPQLLIYAVSYRA
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQAPPT
Download sequence
Identical sequences ENSNLEP00000022468 ENSNLEP00000022468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]