SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022486 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022486
Domain Number 1 Region: 42-382
Classification Level Classification E-value
Superfamily L domain-like 9.35e-56
Family Ngr ectodomain-like 0.0043
Further Details:      
 
Domain Number 2 Region: 426-513
Classification Level Classification E-value
Superfamily Immunoglobulin 2.25e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 526-593
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000789
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022486   Gene: ENSNLEG00000018600   Transcript: ENSNLET00000023625
Sequence length 708
Comment pep:known_by_projection supercontig:Nleu1.0:GL397282.1:1441897:1444352:1 gene:ENSNLEG00000018600 transcript:ENSNLET00000023625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDMPLRIHVLLGLAITTLVQAVDKKVDCPQLCTCEIRPWFTPRSIYMEASTVDCNDLGL
LTFPARLPANTQILLLQTNNIAKIEYSTDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLS
VYLEENKLTELPEKCLSELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN
SKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALVGLENLES
ISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISI
DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNL
KEISIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFRDMMEICL
PLIAPESFPSHLNVEAGSYVSFHCRATAEPQPEIYWITPSGQKLLPNTLTDKFYVHSEGT
LDINGITPKEGGLYTCIATNLVGADLKSVMIKVDGSFPQDNNGSLNIKIRDIQANSVLVS
WKASSKILKSSVKWTAFVKTENSNAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQ
KNRKKCVNVTTKGLDPDQKEYEKSNTTTLMVCLGGLLGIIGVICLISCLSPEMNCDGGHS
YVRNYLQKPTFALGELYPPLINLWEAGKEKSTSLKVKATVIGLPTNMS
Download sequence
Identical sequences G1SAE3
ENSNLEP00000022486 XP_003261243.1.23891 XP_003261244.1.23891 XP_003261245.1.23891 ENSNLEP00000022486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]