SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022554 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000022554
Domain Number - Region: 32-74
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0602
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022554   Gene: ENSNLEG00000018675   Transcript: ENSNLET00000023700
Sequence length 117
Comment pep:novel supercontig:Nleu1.0:GL397535.1:715408:715758:1 gene:ENSNLEG00000018675 transcript:ENSNLET00000023700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFPPANIGHPPNYEMLKEEQEVAVLGAPHNPAPPMSTVIHTHVENSVPNHVVWSLFNTHF
MNSCCLGFIALAYSVKSRDRKMVGDLTRAQAYAFTTKCLNIWALIVHIIMTILLSII
Download sequence
Identical sequences ENSNLEP00000022554 ENSNLEP00000022554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]