SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022644 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022644
Domain Number 1 Region: 32-365
Classification Level Classification E-value
Superfamily L domain-like 3.17e-59
Family Ngr ectodomain-like 0.072
Further Details:      
 
Domain Number 2 Region: 409-500
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-21
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022644   Gene: ENSNLEG00000018774   Transcript: ENSNLET00000023799
Sequence length 606
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:1167198:1169018:-1 gene:ENSNLEG00000018774 transcript:ENSNLET00000023799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETK
ILDLSKNRLKSVNPEEFTSYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLV
PLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE
QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDM
MPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQ
ELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD
CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL
LVDEGQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGM
YVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT
ILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRR
FNMKMI
Download sequence
Identical sequences G1SAV0
ENSNLEP00000022644 XP_003271983.1.23891 XP_003271985.1.23891 XP_003271986.1.23891 XP_012358547.1.23891 ENSNLEP00000022644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]