SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022664 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022664
Domain Number 1 Region: 307-369
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000596
Family RING finger domain, C3HC4 0.034
Further Details:      
 
Domain Number 2 Region: 96-120
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000366
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000022664
Domain Number - Region: 239-263
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000183
Family CCCH zinc finger 0.0046
Further Details:      
 
Domain Number - Region: 395-424
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022664   Gene: ENSNLEG00000018794   Transcript: ENSNLET00000023819
Sequence length 507
Comment pep:known_by_projection supercontig:Nleu1.0:GL397408.1:284705:286949:1 gene:ENSNLEG00000018794 transcript:ENSNLET00000023819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPAAPSEAHEAAGAQAGAEAAREGVSGPDLPVCEPSGESAAPDSALPHAARGWAPFPV
APVPARLRRGGLRPAPASGGGAWPSPVPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPLQSSETERKQMAVGRG
LRFCYYAYRGICFRGESCMYLHGDICDMCGMQTLHPMDAAQREEHMRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHTFCIRCIRRWRSARQFDNRIIKS
CPHCRVTSELVIPSDFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLS
LRDELPLSEDQWDLLHYELEEYFNLNL
Download sequence
Identical sequences ENSNLEP00000022664 XP_003277191.1.23891 ENSNLEP00000022664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]