SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022705 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022705
Domain Number 1 Region: 130-182
Classification Level Classification E-value
Superfamily RING/U-box 6.41e-18
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022705   Gene: ENSNLEG00000018835   Transcript: ENSNLET00000023860
Sequence length 189
Comment pep:novel supercontig:Nleu1.0:GL397308.1:641229:643988:1 gene:ENSNLEG00000018835 transcript:ENSNLET00000023860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKKRHGGAINSRQAQKRTWEATSTPEISLEAEPIELVEAGDEIVDLTCESFEPVVVDL
THDDSVVIADERKRPRRNARRLPQDHADSCAVSSDDEELSRDRDVYVTTHAPRNASDDGA
TGLRPSGTVSCPICMDGYSEIVQNGRLIISTECGHVFCSQCLRDSLKNVNTCPTCRKKIN
HKRYHSIYI
Download sequence
Identical sequences ENSNLEP00000022705 XP_012362076.1.23891 ENSNLEP00000022705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]