SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022759 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022759
Domain Number 1 Region: 243-310
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000011
Family Splicing factor U2AF subunits 0.041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000022759
Domain Number - Region: 309-337
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000772
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number - Region: 174-199
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000916
Family CCCH zinc finger 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022759   Gene: ENSNLEG00000018892   Transcript: ENSNLET00000023917
Sequence length 482
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:11630395:11631882:1 gene:ENSNLEG00000018892 transcript:ENSNLET00000023917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALEKMMFPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLLQKEEEDTFIEE
QQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKWQEEQERELKEQWKEQQ
RKEREEEEQKQQEKKEKEEAVQKMLDQAENELENGTIWQNPEPPVDFRVMEKDRANCPFY
SKTGACRFGHRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQ
FLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGR
QLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDTYLSPDQTGS
SFGKNSERREKMGHHDHYYSRQWGRRNPSPDHSCKRNGESERKRSSHRGKKSHKRTSKSR
ERHNSPSRGRNRHRSRDQGSRSQSRRSRRSHRSRSQSSSRCRSHGRRRSGNRDRTVQSPK
SK
Download sequence
Identical sequences G1SB65
ENSNLEP00000022759 ENSNLEP00000022759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]