SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022793 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022793
Domain Number 1 Region: 287-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-55
Family SPRY domain 0.0000168
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 1.15e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000397
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000022793
Domain Number - Region: 139-225
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0602
Family Apolipoprotein 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022793   Gene: ENSNLEG00000018930   Transcript: ENSNLET00000023955
Sequence length 468
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:31133999:31135405:1 gene:ENSNLEG00000018930 transcript:ENSNLET00000023955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAALTGLQAEAKCSICLDYLSDPVTIECGHNFCRSCIQQSWLDLQELFPCPVCRHRC
QEGHFRSNTQLGRMIEIAKLLQSTKSNKRMQEETTLCEKHNQPLSVFCKEDLMVLCPLCT
QPPDHQGHHVRPIEKAAIHYRKRFCSYIQTLKKQLADLQKLTSTQSKKPLELREMVENQR
QELSSEFEHLNQFLDREQQAVLSRLAEEEKDNQQKLSANITAFSNYSATLKSQLRKVVEL
SELSELELLSQIKIFYESENESSPSIFSIHLKRDGCSFPPQYSALQRIIKKFKVEIILDS
ETAHPNLIVSEDKKCVRFTKRKQKVPGFPKRFTVKPVVLGFPYFHSGRHFWEIEVGDKSE
WAIGICKDSLPTKARRPSSAQQECWRIELQADGYHAPGAFPTPLLLEVKARAIGIFLDYE
MGEISFYNMAEKSHICTFTDTFTGPLRPYFYVGPDSQPLRICTGTVCE
Download sequence
Identical sequences G1SB99
ENSNLEP00000022793 XP_003257977.1.23891 ENSNLEP00000022793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]