SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022879 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022879
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-46
Family G proteins 0.0000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022879   Gene: ENSNLEG00000019022   Transcript: ENSNLET00000024047
Sequence length 198
Comment pep:known_by_projection supercontig:Nleu1.0:GL397406.1:2530447:2531043:-1 gene:ENSNLEG00000019022 transcript:ENSNLET00000024047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQIT
DTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVG
NKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGK
RSGKQKRTDRVKGKCTLM
Download sequence
Identical sequences A0A0A0MWM7 A0A0D9SAW3 A0A2K5BXM5 A0A2K5H983 A0A2K5KYM4 A0A2K5PFU2 A0A2K5UG21 A0A2K6AWK4 A0A2K6JTB2 A0A2K6NUA1 F7E991 G1SBI5 G3QPG9 G7NL76 H2P0P1 H2R6H8 O95057
ENSGGOP00000004462 ENSNLEP00000022879 ENSCJAP00000041813 ENSPTRP00000049130 ENSGGOP00000004462 ENSP00000325836 ENSP00000325836 ENSP00000468417 ENSPANP00000009909 9598.ENSPTRP00000049130 9600.ENSPPYP00000011844 9606.ENSP00000325836 ENSCJAP00000041813 ENSPPYP00000011844 ENSPTRP00000049130 NP_660156.1.87134 NP_660156.1.92137 XP_002834552.1.23681 XP_003277058.1.23891 XP_004059756.1.27298 XP_005587530.1.63531 XP_007992910.1.81039 XP_008970841.1.60992 XP_008985210.1.60252 XP_010373147.1.97406 XP_011746534.1.29376 XP_011819457.1.43180 XP_011928372.1.92194 XP_012291699.1.9421 XP_014977909.1.72884 XP_016790146.1.37143 XP_017362956.1.71028 XP_017717327.1.44346 ENSNLEP00000022879 gi|21553323|ref|NP_660156.1| ENSPPYP00000011844 ENSP00000325836 ENSP00000468417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]