SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022899 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022899
Domain Number 1 Region: 10-165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-37
Family Dual specificity phosphatase-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022899   Gene: ENSNLEG00000019042   Transcript: ENSNLET00000024067
Sequence length 190
Comment pep:known_by_projection supercontig:Nleu1.0:GL397333.1:9138687:9139569:1 gene:ENSNLEG00000019042 transcript:ENSNLET00000024067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASASSFSSSQGVQQPSTYSFSQITSSLFLSNGVAANDKLLLSSNRITAIVNTSVEVVN
VYFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTVDMRQGRTLLHCVAGVSRSASLCLAY
LMKYHSMSLLDAHTWTKRRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIY
EKDLRTILSM
Download sequence
Identical sequences ENSNLEP00000022899 ENSNLEP00000022899 XP_003271072.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]