SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023031 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023031
Domain Number 1 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.84e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 6-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-16
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 313-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000134
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 56-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000226
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 196-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000555
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023031   Gene: ENSNLEG00000019185   Transcript: ENSNLET00000024210
Sequence length 427
Comment pep:known_by_projection supercontig:Nleu1.0:GL397411.1:342899:344179:1 gene:ENSNLEG00000019185 transcript:ENSNLET00000024210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLCWKVFKKPFHLHQHQIIHTGEKPFSCSVCSKSFNRRESLKRHVKTHSADLLRLPCGIC
GKAFRDASYLLKHQAAHAGAGAGGPRPVYPCDLCGKSYSAPQSLLRHKAAHAPPAAAAEA
PKDGAASAPQPPPTFPPGPYLLPPDPPTTDSEKAAAAAAAVVYGAVPVPLLGAHPLLLGG
AGTSGAGGSGASVPGKTFCCGICGRGFGRRETLKRHERIHTGEKPHQCPVCGKRFRESFH
LSKHHVVHTRERPYKCELCGKVFGYPQSLTRHRQVHRLQLPCALAGAAGLPSTQGAPGAC
GPGASGTSAGPTDGLSYACSDCGEHFPDLFHVMSHKEVHMAEKPYGCDACGKTFGFIENL
MWHKLVHQAAPERLLPPTPGGPQPPDGSSGTDAASVLDNGLAGEVGAAVAALAGVSGGED
AGGAAVA
Download sequence
Identical sequences ENSNLEP00000023031 ENSNLEP00000023031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]