SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023067 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023067
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000468
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023067   Gene: ENSNLEG00000019224   Transcript: ENSNLET00000024249
Sequence length 51
Comment pep:novel supercontig:Nleu1.0:GL397262.1:9564721:9564873:1 gene:ENSNLEG00000019224 transcript:ENSNLET00000024249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YCNYPPMKGTCNSYLTRFYYNTLTFLCEPFVFSGCGGNRNNFKQKYICEKM
Download sequence
Identical sequences ENSNLEP00000023067 ENSNLEP00000023067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]