SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023197 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023197
Domain Number 1 Region: 94-271
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.19e-25
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0061
Further Details:      
 
Domain Number 2 Region: 44-88
Classification Level Classification E-value
Superfamily TGS-like 0.0000556
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023197   Gene: ENSNLEG00000002272   Transcript: ENSNLET00000032407
Sequence length 296
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:11184906:11206382:-1 gene:ENSNLEG00000002272 transcript:ENSNLET00000032407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNDFFNKEKARQLSLTPRTEKIEVKHIGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRK
SILALVDGQPWDMYKPLTKSCEIKFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEY
VVNLVRAPEVPVISGAFCYDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVE
AKVALEIFQHNKYKIDFIEEKASQNSERIIKLHRIGDFIDVSEGPLIPRTSICFQYEVSA
VHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKPTEECTST
Download sequence
Identical sequences ENSNLEP00000023197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]