SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023203 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023203
Domain Number 1 Region: 12-156
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000017
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023203   Gene: ENSNLEG00000027082   Transcript: ENSNLET00000031567
Sequence length 179
Comment pep:novel supercontig:Nleu1.0:GL397339.1:10011861:10028217:1 gene:ENSNLEG00000027082 transcript:ENSNLET00000031567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLTRPGDGGTGRPGPPLISRTKCAEPMR
APKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVSLCYHYTLGSSHNQTIRECVKTEQGV
SRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQTDEDGKSLSSNSQGPVYLPQICHV
Download sequence
Identical sequences ENSNLEP00000023203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]