SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023250 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023250
Domain Number 1 Region: 474-758
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.52e-60
Family Eukaryotic proteases 0.00000000011
Further Details:      
 
Domain Number 2 Region: 203-472
Classification Level Classification E-value
Superfamily vWA-like 1.48e-59
Family Integrin A (or I) domain 0.00000000159
Further Details:      
 
Domain Number 3 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000288
Family Complement control module/SCR domain 0.0000194
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000639
Family Complement control module/SCR domain 0.0000237
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000115
Family Complement control module/SCR domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023250   Gene: ENSNLEG00000006427   Transcript: ENSNLET00000031614
Sequence length 764
Comment pep:novel supercontig:Nleu1.0:GL397342.1:8761031:8769685:1 gene:ENSNLEG00000006427 transcript:ENSNLET00000031614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNLSPQLCLMPFILGLLSGGVTTTPLSLARLQGSCSLEGVEIKGGSFRLLQEGQTLEY
MCPSGFYPYPVQTRTCRSTGSWSTLQTQDQKTVKKAECRAIRCPRPHDFENGEYWPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQ
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATYPRIWVKVSEQDSSNADWVTKQLNKINYEDHKLKSGTNTKKALQ
AVYSMMSWPDDIPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFFQMIDESQSLSLCGM
VWEHREGTDYHKQPWQAKISVTRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGKKRDLEIEGVLFHPNYNINGKKEAGIPEFYDYDVALIKLKKKLNYDQTTRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
Download sequence
Identical sequences M3Z963
XP_003272177.1.23891 XP_012358497.1.23891 ENSNLEP00000023250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]