SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023259 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023259
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily C-type lectin-like 1.67e-53
Family Link domain 0.0000000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023259   Gene: ENSNLEG00000017932   Transcript: ENSNLET00000031622
Sequence length 361
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:49809623:49910883:1 gene:ENSNLEG00000017932 transcript:ENSNLET00000031622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGSYIFYTFSTVHSIPDEDGPWITDSTDRTPATRDQDAFHPSGGSHTTHGS
ESAGHSRGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKK
LVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFITADETRNLQNVDMKIG
V
Download sequence
Identical sequences M3Z972
XP_003254459.1.23891 ENSNLEP00000023259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]