SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023279 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023279
Domain Number 1 Region: 1834-2116
Classification Level Classification E-value
Superfamily SAICAR synthase-like 6.76e-77
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0005
Further Details:      
 
Domain Number 2 Region: 709-875
Classification Level Classification E-value
Superfamily GroEL apical domain-like 3.92e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.00055
Further Details:      
 
Domain Number 3 Region: 385-516
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.05e-29
Family DEP domain 0.0038
Further Details:      
 
Domain Number 4 Region: 186-258
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 
Domain Number 5 Region: 661-715,868-888
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00000488
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023279
Domain Number - Region: 1435-1542
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000989
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023279   Gene: ENSNLEG00000007150   Transcript: ENSNLET00000031641
Sequence length 2130
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:52793161:52878833:1 gene:ENSNLEG00000007150 transcript:ENSNLET00000031641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRKVLKSTCRDFSSSLLGFPRTFITLALTHEMATDDKTSPTLDSANDLPRSPTSPSHLT
HFKPLTPDQDEPPFKSAYSSFVNLFRFNKERAEGGQGEQQPLSGSWTSPQLPSRTQSVRS
PTPYKKQLNEELQRRSSALDTRRKAEPTFGGHDPRTAVQLRSLSTVLKRLKEIMEGKSQD
SDLKQYWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLR
ACTYCRKIALSYAHSTDSNSIGEDLNALSDSACSVSVLDPSEPRTPVGSRKASRNIFLED
DLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSPARNRSASITNLSLDRSGSPMVPSYETSV
SPQANRTYVRTETTEDERKILLDSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGK
ELVNWLIRNGHIATRAQAIAIGQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSETP
SPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVD
SDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESL
FNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQAMERLLSANHNHMMALLQQLLHSDS
LSSSWRDIIVSLVCQVVQTVRPDVKNQDDDMDIRQFVHIKKIPGGKKFDSVVVNGFVCTK
NIAHKKMNSCIKNPKILLLKCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPT
LVLVEKTVSRIAQDMLLEHGITLVINVKSQVLERISRMTQGDLVMSMDQLLTKPHLGTCH
KFYMQIFQLPTEQTKTLMFFEGCPQHLGCTIKLRGGSDYELARVKEILIFMICVAYHSQL
EISFLMDEFAMPPTLMQNPSFHSRFEGRGHEGAVQEQYGGGSLPWDPDIPPESLPCDDSS
LLESRIVFEKGEQENKNLPQAVASVKHQEHSTTACPAGLPCAFFAPVPESLLPLPVDDQQ
DALGSEQPESLQQTVVLQDPKSQIRAFRDPLQDDTGLYVTEEVTSSEDKRKTYSLAFKQE
LKDVILCISPVITFREPFLLTEKGMRCSTRDYFAEQVYWSPLLNKEFKEMENRRKKQLLR
DLSGLQGMNGSIQAKSIQVLPSHELVSTRIAEHLGDSQSLGRMLADYRARGGRIQPKNSD
PFAHSKDASSTSSGKSGSKNEGDEERGLILSDAVWSTKVDCLNPINHQRLCVLFSSSSAQ
SSNAPSACVSPWIVTMEFYGKNDLTLGIFLERYCFRPSYQCPSMFCDTPMVHHIRRFVHG
QGCVQIILKELDSPVPGYQHTILTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGH
QYTRRANAEPCGHSIHHDYHQYFSYNQMVASFSYSPIRLLEVCVPLPKIFIKRQAPLKMS
LLQDLKDFFQKVSQVYLAIDERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWIEKM
QARLMSSSVDTPQQLQSVFESLIAKKQSLCEVLQAWNNRLQDLFQQEKGRKRPSVPPSPG
RLRQGEESKISAMDASPRNISPGLQNGEKEDRFLTTLSSQSSTSSTHLQLPTPPEVMSEQ
SVGGPPELDTASSSEDVFDGHLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDK
HYLMYEHERVPIAVCEKEPSSIIAFALSCKEYRNALEELSKATQWNSAEEGLPTNSTSDS
RPKSSSPIRLPEMGGGQANRTAETEPQPTKKPSGMLSFFRGTAGKSPDLSSQKRETLRGA
DSAYYQVGQTGKEGTDNQGVEPQDEVDGGDTQKKQLINPHVELQFSDANAKFYCRLYYAG
EFHKMREVILDSSEEDFIRSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFL
DFAPHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQ
VFDLKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKAVLRTSIHSDSHF
LSSHLIIDYSLLVGRDDTSNELVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVS
PELYRTRFCEAMDKYFLMVPDHWTGLGLNC
Download sequence
Identical sequences ENSNLEP00000023279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]