SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023291 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023291
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.15e-36
Family MHC antigen-recognition domain 0.0000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023291   Gene: ENSNLEG00000010201   Transcript: ENSNLET00000031651
Sequence length 208
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:6756010:6758195:1 gene:ENSNLEG00000010201 transcript:ENSNLET00000031651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQISYFRDPYHVWYQGNASLGGHLTHVLEGPSTNTTIIQLQPLQEPESWVRTQSGLQSYL
LQFHSLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALW
QADTQVTSGVVTFVLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTS
LVLGVLVGSFIIAGVAVGIFLCTGGRRC
Download sequence
Identical sequences ENSNLEP00000023291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]