SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023311 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023311
Domain Number 1 Region: 18-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.95e-60
Family G proteins 0.0000000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023311   Gene: ENSNLEG00000012495   Transcript: ENSNLET00000031677
Sequence length 219
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:2646504:2703061:-1 gene:ENSNLEG00000012495 transcript:ENSNLET00000031677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAGDPPAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDVANQESFAAVQDWATQI
KTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV
DVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Download sequence
Identical sequences A0A0D9R3C0 A0A2I3MXN8 A0A2K5MSY4 A0A2K5TXE2 A0A2K5XPB6 A0A2K6DRX4 A0A2K6KFI5 A0A2K6PM26 F6UG33 G1RPK5
ENSMMUP00000014842 ENSNLEP00000015169 ENSMMUP00000014842 9544.ENSMMUP00000014842 ENSPANP00000009849 NP_001181198.1.72884 XP_003275802.1.23891 XP_005588068.1.63531 XP_007993482.1.81039 XP_010372023.1.97406 XP_010372024.1.97406 XP_011724920.1.29376 XP_011724995.1.29376 XP_011850243.1.47321 XP_011949237.1.92194 XP_011949238.1.92194 XP_012365009.1.23891 XP_014978398.1.72884 XP_015296020.1.63531 XP_017724955.1.44346 XP_017724956.1.44346 ENSNLEP00000015169 ENSNLEP00000023311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]